PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D08G1449
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 296aa    MW: 32946.5 Da    PI: 7.9679
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D08G1449genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.58.6e-151461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W +eEde+l +++k+ G g+W++ ++  g+ R++k+c++rw +yl
      Gh_D08G1449 14 KGPWAPEEDEILTNYIKKRGHGSWRSLPKLAGLLRCGKSCRLRWTNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding48.71.8e-1567112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T eE++l +++++ lG++ W++Ia+ ++ +Rt++++k+ w+++l
      Gh_D08G1449  67 RGPFTLEEEKLVIQLHAILGNR-WAAIAAQLP-RRTDNEIKNLWNTHL 112
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.8E-24564IPR009057Homeodomain-like
PROSITE profilePS5129415.563961IPR017930Myb domain
SuperFamilySSF466891.49E-2811108IPR009057Homeodomain-like
SMARTSM007173.3E-101363IPR001005SANT/Myb domain
PfamPF002497.0E-131461IPR001005SANT/Myb domain
CDDcd001672.57E-81661No hitNo description
PROSITE profilePS5129424.77662116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.3E-2565116IPR009057Homeodomain-like
SMARTSM007173.1E-1466114IPR001005SANT/Myb domain
PfamPF002491.5E-1467112IPR001005SANT/Myb domain
CDDcd001679.47E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0009909Biological Processregulation of flower development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MGRTPCCDKK GLKKGPWAPE EDEILTNYIK KRGHGSWRSL PKLAGLLRCG KSCRLRWTNY  60
LRPDIKRGPF TLEEEKLVIQ LHAILGNRWA AIAAQLPRRT DNEIKNLWNT HLKKRLLCMG  120
LDPQTHKPFT PCGGPTVAAP TSPATRHMAQ WESARLEAEA RLSKESLQTN SPPIAKPDSD  180
HFLRLWNSEV GESFRKINTE YKTVYPCPSP ISQTSSSTKC GSVSAVTMDV CPNIAGSLNP  240
ASNPIEETEC KSFIKSCIEE PSDSSCSSES EDSSDTALQL LLDFPINNDM SFLENC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-26121165108B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.38040.0ovule
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00114ampDAPTransfer from AT3G61250Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ4591819e-71AJ459181.1 Gossypium hirsutum partial myb151 gene, clone pGhMYB151.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012475173.10.0PREDICTED: myb-related protein 308-like
TrEMBLA0A0D2S0B20.0A0A0D2S0B2_G
STRINGPOPTR_0014s07700.11e-146(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM69822643
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61250.11e-122myb domain protein 17